Thumbnail avatar cfdaf30a8d

tornadowave90

If something in this post is copy, and pasted, I'll do my best to put it in quotes.

 

     Misophonia literally means "The hatred of sound". It is " a condition in which negative emotions, thoughts, and physical reactions are triggered by specific sounds". There has been little research, and there is no treatment. Most of the time there is just one or a few sounds that really bother a person. These are called "Trigger-Sounds". "People with misophonia are aware that the sounds that trigger them don’t bother other people." So, FINGERNAILS ON A CHALKBOARD TO NOT COUNT.

 

     Misophonia is very real, we just no next to nothing about. Scientists think it's a brain issue, but there is no way of knowing. Please don't say "Get over it" or "Ignore it", or anything. If you had experienced it, you would know that is not helpful. Sometimes, in rare cases, something visual can cause this distress, too.

 

My Trigger Sounds:

 

Chalk. On anything. Roads, sidewalks, chalboards... At first it started with just the sound. Over time it eveolved, and the sight of a chalkboard makes me uneasy. Maybe it's just the fear that I may soon here the sound...

 

Other people eating, especially with mouth open. Crunching, slirping, chewing, it all bothers me. While I myself eat, I feel better with some sort of sound in the backround, to help cancel out the noise.

 

When people press to hard on the paper with their pencils while writing. COME ON PEOPLE, REALLY?

 

 

 

     What are your trigger sounds? What are your tips for others? I know I can't be the ONLY ONE here who suffers!

  • Posted at:

Please tell us why you'd like to report this post

~Tornado~Rey~Poet~

 

I'm a Star Wars Geek Jedi.

 

Yes, I do play the clarinet. And yes, I do know how to play notes so high they'd make you go deaf. AND I'M NOT AFRAID TO USE THEM.

 

Why are you still reading this...? Scroll down!

Thumbnail avatar 225834ad9b

lokiclever11

I have not been officially diagnosed but having known of this condition a while and knowing the signs of it, I'm sure I have it. I have bad hearing, but somehow I can hear someone chewing or tapping from the other side of the room, like my brain is seeking out something to frustrate me. It's terrifying how angry it makes me for no reason other than noise.

 

Also, a few studies have shown (from what I've read, I could be wrong because I haven't really gone into studying this intensely) that misophonia may be caused by a trauma in early childhood. So, could be that. Somehow.

  • Posted at:

Please tell us why you'd like to report this post

L A K A E L / L O K I

 

"Oh, you fool

There are rules

I am coming for you

You can run,

But you can't be saved..."

-Yawning Grave, Lord Huron

 

MINIORITY GROUPS MATTER. 

 

HE WILL NOT DIVIDE US.

Thumbnail avatar cfdaf30a8d

tornadowave90

I can't think of anything in my past that would make those sounds annoy me. But I sometimes get violent reactions. I pull my own hair, throw things, yell. It's not good.

 

Just to make matters even better *note sarcasm*, I am also Claustrophobic (From people, not tight spaces as much) and Lilapsophobic (The extreme fear of tornadoes and hurricanes).

  • Posted at:

Please tell us why you'd like to report this post

~Tornado~Rey~Poet~

 

I'm a Star Wars Geek Jedi.

 

Yes, I do play the clarinet. And yes, I do know how to play notes so high they'd make you go deaf. AND I'M NOT AFRAID TO USE THEM.

 

Why are you still reading this...? Scroll down!

Thumbnail avatar 7aab741b8f

pinkpuppy1315

My Trigger Sounds:

When certain people are chewing. It's not with everyone. Sometimes I'm fine with the sounds of someone eating, and sometimes, but not very often, it can even trigger my ASMR. But other times, and with certain people, it triggers my misophonia instead. Lunch in the cafeteria was horrible. Almost every single kid in the cafeteria always chewed with their mouth open and it was gross and really annoying. My friends would do it just to annoy me.

 

This is a bit weird, but when my mom rubs her fingers together. The sound that it makes is, for some reason, the worst thing ever for me. It doesn't usually happen with other people, but when it does it's usually with older adult women, like my mom. I don't know why. I have no idea why. Maybe it has something to do with dry skin?

  • Posted at:

Please tell us why you'd like to report this post

~Puppy Traitare Hamiltonia~

Aka Spider Puppy, Dog Child, Puppeh, Ghost Puppy, or Doggo

Gang:

Angelica Luise

Selena

Bliss!!!

Briggan

Mist

Violet

Flame

#BobcatSquad

#RickRollSquad

#IkilledNightRobin

SAMBer of the day: Snow

Thumbnail avatar 1edcc72a9a

downpourdolphin66

You know when people scrape their pencils on their desks? That's one of my trigger sounds.

 

My Trigger Sounds:

 

Skidding of any kind

 

Things crashing into windows

 

People tapping on their desks

 

The groaning of my school's toilets

 

Wind-chime noises

  • Posted at:

Please tell us why you'd like to report this post

Rainfeather

 

Dragonkin

 

 That one crazy sister & fireball goddess

 

 #Likeagirl

 

"YOU ATE MY SWORD!!"-Percy Jackson

 

 

Current music obsession:Horrible Kids

 

 #UnbanCrimson

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

Thumbnail avatar f32bee0135

wolfmagic494

I have not been diagnosed, but here are some of my trigger sounds: 

 

People cutting or filing their nails

 

The sound of firecrackers (not fireworks there is a difference)

 

People chewing (sometimes)

 

The ripping or tearing of paper or plastic

 

 

I also am claustrophobic and have arachnophobia  

  • Posted at:

Please tell us why you'd like to report this post

I am Rose

0

Rosepetal

o

A Daughter of Poseidon

9

Gryffindor

 1

An animal lover

0 

A Greencloak

 H

A wolf lover

                    

"Look for the bare necessities..." -Baloo the Bear

 

"Hakuna Matata..." -Timon and Pumbaa 

 Hello

#SavetheSouthernResidents

 

 

 

 

 

 

 

 

 

Thumbnail avatar 29d6ade36f

hunterwolf85

I think my dad has this condition.

  • Posted at:

Please tell us why you'd like to report this post

(( Ł Ë Ø )

f o r u m p h a r a o h

violinist // whovian // ENFJ // slytherin // aries

"in blushing light, just another la devotee"

Utensil Police // Duck Cultist

#AllPeopleArePeople

            spooky

Thumbnail avatar 950d10dcf3

lynxadventure425

OMG Every Time Think Of Chankboard Literally Wanna Bite My Fingers Off!!!

Its so annoying for me!!!

  • Posted at:

Please tell us why you'd like to report this post

.~*{Lynx}*~.

DArkSide

^{Shadow}^

I'mNOTClay

 

'~Phoenix~'

 

I❤️Wolves

 

01/12/17

Always Remember you are braver than you believe, stronger than you seem and twice as beautiful as you ever IMAGINED.

Queeof: Pineapples Unicorns

Okie dokie loki! ~Lynx

 

 

Thumbnail avatar 2b4e58a204

brownwolf123

I may have this...

 

-Eating, period (sometimes hearing myself eat triggers me). The sound and sight of it.

 

-I'm not sure the name of the sound, but when someone kind of goes "Uch." I think it's some sort of groan or moan or something. Gets on my nerves (especially when I hear my nana do it).

 

-Literally, the sound of my nana's voice. Just hearing her speak or make any noise now just makes me so mad AND I'M NOT EVEN SURE WHY. Just seeing her walking in my general direction makes me want to high-tail it out of there.

 

PLEASE LET THIS POST!

  • Posted at:

Please tell us why you'd like to report this post

Prank

CSBCJRKJPBSKS

MMMTBT

ASMJMRMNSUTM

RDPPFP

MMMMPL

CALLUZFCBPTPJEIBKSKKNBAMKS

GLMSZGMEAWASMFC

RWBYZSPHELVONYX

HNSAHU

FrKeAlHeChMN

SiFlCMAySaSiYuRyTkYkSAIbMyGyViElSBCa

MoMvPcWaSmOlIdNgSn

YnYgH/HYiYaSpLeDr

SuTaMgMDJDkRiKuKaRMGL

RSFSSIAMPRSMKCRHSPKHMRICESCPMMNY

Thumbnail avatar 48dde136c9

slypuppy15

I think I have misophonia. I'm not so sure yet, though.

  • Posted at:

Please tell us why you'd like to report this post

                                      Kya

Why must things so beautiful and filled with hope, be the most fragile and delicate?

Summoned Tellun

#Kyli

 

4Play the moments.

; Pause the memories.

<Stop the pain.

7 Rewind the happiness.

EvNyCiJoIvAcKaJaAbAlLy

Thumbnail avatar a5e6e0b3f2

whitetiger1202

I do.

 

Chalk is the worst one, the sound of pencils, dishes clanking together, etc.

  • Posted at:

Please tell us why you'd like to report this post

➳ Sphinx ➳

 

 

Forum Guardian

 

Recipient of Mickey's Respect.

 

 

#Sphinoki (And Prince Sidon too!)

#FreaksLikeMe<3

#MarySuePride

 

ϟ Vine: Forum Twin ϟ

 

Check out my story that I'm writing on the 39CMB! /263177

Thumbnail avatar 6c60b26e26

opalunicorn581

One of mine is erasing pencil

  • Posted at:

Please tell us why you'd like to report this post

Elpis

Queen of Alpacas, Glitches, and Lemony Snickets

 

Gang:

Kynigos, Matthias, Xander, Lilo, Tarik, Valerie, and Vincent.

 

I am a Divergent, Slytherin, Demigod

 

#GreySide

#AllHailPurple

#TrashSquad

Thumbnail avatar a5e6e0b3f2

whitetiger1202

And on top of that I have pupaphobia.

 

Fun.

  • Posted at:

Please tell us why you'd like to report this post

➳ Sphinx ➳

 

 

Forum Guardian

 

Recipient of Mickey's Respect.

 

 

#Sphinoki (And Prince Sidon too!)

#FreaksLikeMe<3

#MarySuePride

 

ϟ Vine: Forum Twin ϟ

 

Check out my story that I'm writing on the 39CMB! /263177

Thumbnail avatar 7542be23f2

eagledragon2361

The sound of people blowing their nose is just so- *shudders* 

  • Posted at:

Please tell us why you'd like to report this post

Bobcat

        Here there be salamanders

Proud Mormon!

          #Uniteabrow

 

     "A student in bed will remain in bed,

          unless acted upon by a large enough panic."

                -Newton's Lesser Known 4th Law of Motion

/298740 ;D

Thumbnail avatar cc196c6aa1

silverdragon5009

I haven't been diagnosed, but I know for sure that I have a trigger-sound.

 

It is.......

 

Mechanical Pencils.

 

Not the new super cool ones, but the first kind that are cheap and very plastic. TONS of people in my school use them and the noise makes me hurt. If I ask a person who is using one to try and stop making the noise, they're usually like, There's no noise and no one else around is clearly bothered. Does anyone else feel the same way?

  • Posted at:

Please tell us why you'd like to report this post

 

ABYSS

 

Also called Jay or Silver

Night/SeaWing

 

 #PROUDFANWING

Star Count: 201

Home Thread /256501

Previously active on /270501 and /270394

ʕ✧ᴥ✧ʔ

 

 

#MoreMudWings!

 

Sundance: Rebellion

Poseidon: Rebellion

 

Thumbnail avatar 4c46865d32

joyfulcat108

Any type of rubbing triggers mine. Scrubbing, sliding, and hard rubbing on any surface makes me want to shrivel up.

 

 

I can't stand marbles repeatedly hitting metal, operation (the buzzing sound), and when one normal sound is played over and over in a eternal sequence,

  • Posted at:

Please tell us why you'd like to report this post

         ✨I am Dreamkeeper...

           Chi Master, Shadow Magerandom other stuff

  Queen of ailurophiles and world domination

 

I used to exist. Perhaps I shall again. Or maybe the time has come, and this is now the end. 

Thumbnail avatar ab1cf17417

forestfield23

I used to be extremely sensitive to crinkling tissues.

 

It doesn't affect me much anymore.

 

I still don't like tissues.

 

 

DIE, TISSUES

  • Posted at:

Please tell us why you'd like to report this post

-– Earth –-

 

a fresh start

 

respect yo mama

 

I'm ready to forgive you,

but forgetting is a harder fight

Little do you know, I,

need a little more time

 

thread ghost

 

#HopeForSalt

 

Do you really know who I am?

 

Thumbnail avatar 0e294bc7a0

silvermist539

Sorry, I do not. But I hate when people rub balloons with damp hands. The noise it makes... ugh! Rhett and Link (GMM) did a video on misophonia, and I was not affected what-so-ever. 

  • Posted at:

Please tell us why you'd like to report this post

-Joy/Aloebre.exe

 

 

Books are like flypaper, memories cling to the printed pages better than anything else.

   

"Stories never really end, even if the books pretend they do. They don't end on the last page, anymore than they begin."

Thumbnail avatar 58428067b5

birdteal69

Yeah, I have that. Mine is ripping velcro, I can't stand it. The noise makes my ears ring.

  • Posted at:

Please tell us why you'd like to report this post

Wants to be an architect

Loves Math

Sorry, that's the truth

Thumbnail avatar 62cd068e10

detectiveunicorn26

I have not been diagnosed, but I do have trigger sounds.

 

Filing nails, the sound of a pencil dropping, this one sound someone in my class makes(I don't think he means to), the sound a train makes when it stops, etc.

  • Posted at:

Please tell us why you'd like to report this post

Katty/Rilen/Deerkit Queen of Drama and RPs

I am a gem, a demigod, and much more!

#ThinkoftheⓈⓤⓝⓢⓗⓘⓝⓔ!  #reilen #cabake #adoptarescue

 Under Construction Under Construction

Thumbnail avatar 7aab741b8f

pinkpuppy1315

@Tornado: You know, it's a bit ironic that you have a fear of tornadoes and hurricanes, yet your nickname is Tornado.

 

@Everyone else saying their fears also: I have arachnophobia, basically the fear of all bugs and scorpions. I don't know what the names for those fears are). I also have claustrophobia, and another fear that's similar to claustrophobia, but different. It's the fear of being trapped somewhere, I don't know what the name of that fear is. I also have a bunch of other fears. Yeah, I'm a mess :D

  • Posted at:

Please tell us why you'd like to report this post

~Puppy Traitare Hamiltonia~

Aka Spider Puppy, Dog Child, Puppeh, Ghost Puppy, or Doggo

Gang:

Angelica Luise

Selena

Bliss!!!

Briggan

Mist

Violet

Flame

#BobcatSquad

#RickRollSquad

#IkilledNightRobin

SAMBer of the day: Snow

Thumbnail avatar cfdaf30a8d

tornadowave90

@Puppy- Before I say this, I want you to know that I'm a complete geek and nerd. I have always been horrified of tornadoes. When I was younger, I wanted to be an astronomer (and this is THIRD GRADE). I live in Ohio, so tornadoes happen. We got hit by one late at night, and I was more scared than ever. I decided to learn more about tornadoes. Then I wanted to learn more about weather. Now, since about first grade, I want to be a meteorologist. It's my passion. Without the power of Tornadoes, I wouldn't be who I am today. Not even close. The name means something to me... So now I am Tornado. And I would do anything to keep that name here.

 

O_O That sounded deep...

  • Posted at:

Please tell us why you'd like to report this post

~Tornado~Rey~Poet~

 

I'm a Star Wars Geek Jedi.

 

Yes, I do play the clarinet. And yes, I do know how to play notes so high they'd make you go deaf. AND I'M NOT AFRAID TO USE THEM.

 

Why are you still reading this...? Scroll down!

Thumbnail avatar f32bee0135

wolfmagic494

@Puppy: You are probably the first person that I have met who has said that they have arachnophobia and are claustrophobic. No one in my family or in my class has these fears. I was like: "What? How am I seriously the only one."

  • Posted at:

Please tell us why you'd like to report this post

I am Rose

0

Rosepetal

o

A Daughter of Poseidon

9

Gryffindor

 1

An animal lover

0 

A Greencloak

 H

A wolf lover

                    

"Look for the bare necessities..." -Baloo the Bear

 

"Hakuna Matata..." -Timon and Pumbaa 

 Hello

#SavetheSouthernResidents

 

 

 

 

 

 

 

 

 

Thumbnail avatar 2a15acccfc

dragonwolf2982

YES I KNEW THIS WAS BURIED SOMEWHERE.

 

I developed this, for chewing with your mouth open. (IhategumIhategumIhategum...) Or really just lip smacking in general...

 

*Listening to music way too loud just to block out my dad's chewing*

  • Posted at:

Please tell us why you'd like to report this post

Call me Eternity EternaFlame

I'm Katrina, her flipside

 

Gang @/287587

 

#EternityIsAPancake

#OnlyOneSpeshalBubbles

#SaveIsaac2k17

 

UNDERTALE fan

Pegasister

 

I am:

a Fanwing!

the Keeper!

a writer!

an Icecream!

a READER!!!!!!

 

"I'm afraid, and that is why I fight."

Not rlly, but I have biotin deficincy.  

  • Posted at:

Please tell us why you'd like to report this post

 

Leafwhisker

Wolfstar

Tigerfang

Stormypaw

Lulupaw

Whitefoot

Hornetfire

Hornetflick

Daisyleaf

 

#Icewhisker!

 

I'm weird. Get used to it

 

Im mostly insane; you?

 

*~Christian~*

 

Currently have 1 dog

 

#OnlyOneSpeshalBubbles

 

"Geoduck- it looks like a naked turtle."

Thumbnail avatar 2a15acccfc

dragonwolf2982

HE'S STOPPED OH THANK GOODNESS

  • Posted at:

Please tell us why you'd like to report this post

Call me Eternity EternaFlame

I'm Katrina, her flipside

 

Gang @/287587

 

#EternityIsAPancake

#OnlyOneSpeshalBubbles

#SaveIsaac2k17

 

UNDERTALE fan

Pegasister

 

I am:

a Fanwing!

the Keeper!

a writer!

an Icecream!

a READER!!!!!!

 

"I'm afraid, and that is why I fight."

What is Misophonia?

  • Posted at:

Please tell us why you'd like to report this post

You Can Call Me HOPE!!

 

#PumpedUp

 

#PartCat

 

#PeaceLove

Thumbnail avatar 08cbf77e00

wolfpaw1527

wat

  • Posted at:

Please tell us why you'd like to report this post

Nacho

 

MINECRAFT

SAMB

ROBLOX            AND PEGGY!

WOLFQUEST

POKEMON

GO

 

 

Foxcraft

Wolfey

Phillip

Benny

Nacho.exe

 

 EVERYBODY DO THE DAB

Thumbnail avatar b663ac9925

eagledragon1343

i also hate chewing sounds but i never thought of it as  misophonia or anything

 

i hate the sounds of anyone chewing including me with kinda sucks

  • Posted at:

Please tell us why you'd like to report this post

eve

|11/17/2013|virgo|slytherin|infj-t|chaotic good|christian|kuudere|

 

the world around us is burning but we're so cold

it's the few, the proud, and the emotional
Thumbnail avatar eb9dabf773

platinumdragon2816

Yikes... That stinks...

  • Posted at:

Please tell us why you'd like to report this post

Dusk

#Stopcyberbullying

 

Xx you did this to me xX

 

 

Life is a cruel game 

Thumbnail avatar 57dacc9791

actorbrainy16

@Puppy: That similar fear (if it's what I think it is) is called cleisiophobia. And I think I have it, too.

  • Posted at:

Please tell us why you'd like to report this post

Andra/Emmi Myth-Desitjo-Wilddliw 

Christian †

Actress :-D D-:

Writer => ~

Autistic :'P

Singer ♪

etc...

  

"I can do all things through Christ who strengthens me."

Philippians 4:13

 

MeJoKeDuAnRaCaAcShLuKaLeOd

 

#AllLivesMatter

#GodBlessAmerica

Sig@289964

Thumbnail avatar 2a15acccfc

dragonwolf2982

@Everyone who just posted: Check the date

  • Posted at:

Please tell us why you'd like to report this post

Call me Eternity EternaFlame

I'm Katrina, her flipside

 

Gang @/287587

 

#EternityIsAPancake

#OnlyOneSpeshalBubbles

#SaveIsaac2k17

 

UNDERTALE fan

Pegasister

 

I am:

a Fanwing!

the Keeper!

a writer!

an Icecream!

a READER!!!!!!

 

"I'm afraid, and that is why I fight."

@Eternity: Someone bumped dis on purpose. So I just posted this cause I wanted to tell people about my. . . . . I dunno, condition? Disease? Whatever it is, I wanted to tell people about my biotin deficiency sometime, anyways.

  • Posted at:

Please tell us why you'd like to report this post

 

Leafwhisker

Wolfstar

Tigerfang

Stormypaw

Lulupaw

Whitefoot

Hornetfire

Hornetflick

Daisyleaf

 

#Icewhisker!

 

I'm weird. Get used to it

 

Im mostly insane; you?

 

*~Christian~*

 

Currently have 1 dog

 

#OnlyOneSpeshalBubbles

 

"Geoduck- it looks like a naked turtle."

Thumbnail avatar 2a15acccfc

dragonwolf2982

@Leafwhisker: That someone was me. XD

 

I just bumped it because I developed misophonia I'm tired of my parents just getting mad and saying "get over it".

  • Posted at:

Please tell us why you'd like to report this post

Call me Eternity EternaFlame

I'm Katrina, her flipside

 

Gang @/287587

 

#EternityIsAPancake

#OnlyOneSpeshalBubbles

#SaveIsaac2k17

 

UNDERTALE fan

Pegasister

 

I am:

a Fanwing!

the Keeper!

a writer!

an Icecream!

a READER!!!!!!

 

"I'm afraid, and that is why I fight."

Thumbnail avatar b663ac9925

eagledragon1343

@eternity

 

cant. mobile.

  • Posted at:

Please tell us why you'd like to report this post

eve

|11/17/2013|virgo|slytherin|infj-t|chaotic good|christian|kuudere|

 

the world around us is burning but we're so cold

it's the few, the proud, and the emotional
Thumbnail avatar 2a15acccfc

dragonwolf2982

@Eve: Ohhhhhh, sorry about that.

 

This was posted a few months ago.

  • Posted at:

Please tell us why you'd like to report this post

Call me Eternity EternaFlame

I'm Katrina, her flipside

 

Gang @/287587

 

#EternityIsAPancake

#OnlyOneSpeshalBubbles

#SaveIsaac2k17

 

UNDERTALE fan

Pegasister

 

I am:

a Fanwing!

the Keeper!

a writer!

an Icecream!

a READER!!!!!!

 

"I'm afraid, and that is why I fight."

Misophonia sounds like when you're going for the phone because it has like two rings less and by the time you picked it up the other person already gave up

  • Posted at:

Please tell us why you'd like to report this post

Aphrodite

 

"Forgiveness. Can you imagine?"

"When you're living on your knees, you rise up." 

"I'm not here for you." 

 

 

 

 

 

 

 

 

I may develop it if my brothers keep getting in trouble and making my parents yell at them. I'm already becoming depressed. . . . .

  • Posted at:

Please tell us why you'd like to report this post

 

Leafwhisker

Wolfstar

Tigerfang

Stormypaw

Lulupaw

Whitefoot

Hornetfire

Hornetflick

Daisyleaf

 

#Icewhisker!

 

I'm weird. Get used to it

 

Im mostly insane; you?

 

*~Christian~*

 

Currently have 1 dog

 

#OnlyOneSpeshalBubbles

 

"Geoduck- it looks like a naked turtle."

Thumbnail avatar 8bf0113d39

dogdragon1303

Any super loud noises, sneezes (I actually sometimes get angry at people when they sneeze...whoops.)

  • Posted at:

Please tell us why you'd like to report this post

Embyr Liz

Call me Embyr

 

Proud Christian!

 

 Proud to be straight.

Queen of Lizards

 Honestly. It's the honest ones you have to look out for.

 

I'd rather stand with God, and be judged by the world, than stand with the world, and be judged by God.

Thumbnail avatar 40abf2ade0

wolfdreamer127

I don't know if this is Misophonia or not but I hate the squeak a cheap mechanical pencil makes on paper as you are writing or when somebody simply drops a pen or pencil.

  • Posted at:

Please tell us why you'd like to report this post

 

 

Shei(Me);Seikatsu;Ongaku;Mizu;Kateikyōshi;Kasai;Mirai;Furaito

Philosopher: a person who studies Hakuna Matata

I am known as Wolfie,Shei,Caress,Tetsugakumono,and Okami but who am I really?

Sootkit and Sagekit!