Thumbnail avatar ec5c3bd0f4

rabbitpaw36

This is how it works:

 

One person thinks of something related. They post this ONE word. The next person looks at this word and posts the first thing that comes to mind when they hear the word from the person before. And then- Well, you get the point. 

 

 

 

Rule #1: You can't post a new word about your previous own word. (Like if I posted "Classic" I couldn't respond to my own post by saying "Hat") 

Rule #2: Have fun!

 

Fluffeh.

  • Posted at:

Please tell us why you'd like to report this post

Sunshine

Or Sakari

 

You're my constant in every moment

Constant

You've never failed me

All my life

You have never left my side

You are my constant

 

#SaveTheSouthernResidents

 

 

#StandWithSeaWorld

 

It never hurts to keep looking fosunshine.-Eeyore

Thumbnail avatar af0c6c6246

skyscraperarrow12

UNICORN!!

 

oh wow... i miss her now dat i think about it...

  • Posted at:

Please tell us why you'd like to report this post

Destiny, Mai, Meanie, Dune, Mina

Rem:Scarlet/Soul

?WHO AM I REALLY?

A Warrior?

A Seeker?

A Fighter?

A Greencloak?

A Hero?

A Musician?

A Reader?

A Survivor?

A Challenger?

A Normal Girl?

A Ninjago Fan?

 

Turns out...

 

I'm all of them

 

And that's who I will always be...

Thumbnail avatar db756fcab7

artkitten320

strawberry

  • Posted at:

Please tell us why you'd like to report this post

         ∆ Icicle

nerd | musical trash | INTJ-T | scorpio

 

"Now it's time to say goodbye

To the things we loved....

How the time seemed to fly."~RWBY

Thumbnail avatar ec5c3bd0f4

rabbitpaw36

Seed

  • Posted at:

Please tell us why you'd like to report this post

Sunshine

Or Sakari

 

You're my constant in every moment

Constant

You've never failed me

All my life

You have never left my side

You are my constant

 

#SaveTheSouthernResidents

 

 

#StandWithSeaWorld

 

It never hurts to keep looking fosunshine.-Eeyore

Thumbnail avatar cd5765a161

wizardwolf1120

olaf. (Don't question.)

  • Posted at:

Please tell us why you'd like to report this post

   Night Is My Domain

 

      NIGHTINGALE/LUX

        αηδόνι      

 

 

#MaryDidYouKnow?

#KristaEllieDiya

Trust No One

 

 You Could Say I Am A Crazy Cahill. 

 

How am I gonna be a optimist about this?

Thumbnail avatar d3a59d09ec

ravenfairy134

Elsa

  • Posted at:

Please tell us why you'd like to report this post

morningstar

 

who can say if i've been changed for the better, but

because i knew you

i have been changed

for good    

 

 

 

paalam at salamat, samb.

coming back for a bit, but don't count on it

(translation: goodbye and thank you, samb.)

Thumbnail avatar ec5c3bd0f4

rabbitpaw36

Snowman

  • Posted at:

Please tell us why you'd like to report this post

Sunshine

Or Sakari

 

You're my constant in every moment

Constant

You've never failed me

All my life

You have never left my side

You are my constant

 

#SaveTheSouthernResidents

 

 

#StandWithSeaWorld

 

It never hurts to keep looking fosunshine.-Eeyore

Thumbnail avatar d3a59d09ec

ravenfairy134

Sparkles

  • Posted at:

Please tell us why you'd like to report this post

morningstar

 

who can say if i've been changed for the better, but

because i knew you

i have been changed

for good    

 

 

 

paalam at salamat, samb.

coming back for a bit, but don't count on it

(translation: goodbye and thank you, samb.)

Thumbnail avatar cd5765a161

wizardwolf1120

Emoji

  • Posted at:

Please tell us why you'd like to report this post

   Night Is My Domain

 

      NIGHTINGALE/LUX

        αηδόνι      

 

 

#MaryDidYouKnow?

#KristaEllieDiya

Trust No One

 

 You Could Say I Am A Crazy Cahill. 

 

How am I gonna be a optimist about this?

Thumbnail avatar ec5c3bd0f4

rabbitpaw36

Smiley

  • Posted at:

Please tell us why you'd like to report this post

Sunshine

Or Sakari

 

You're my constant in every moment

Constant

You've never failed me

All my life

You have never left my side

You are my constant

 

#SaveTheSouthernResidents

 

 

#StandWithSeaWorld

 

It never hurts to keep looking fosunshine.-Eeyore

Thumbnail avatar c1636145e5

greenstorm25

Bob. (This was actually the first thing that came to mind)

  • Posted at:

Please tell us why you'd like to report this post

Waffle (Hart Traitare)

ISFP

She/her

Whovian

Hufflepuff

Socially inept

Perpetually tired, stressed, and confused

Proud member of The Church of Jesus Christ of Latter Day Saints

 

 

 yeehaw

 

 

 

 

Thumbnail avatar a758e84bb2

athenaemerald194

-something inappropriate-

 

Apples

  • Posted at:

Please tell us why you'd like to report this post

 

just letting you know i'm still alive

title your next post sticky mochi if you see this

Thumbnail avatar 6fc1c6d408

chickendragon428

pineapples

  • Posted at:

Please tell us why you'd like to report this post

Cervidae

 

Hit or miss, I Guess she took the kids huh? 

Now I'm crying don't have no will to live, yuh

Gonna get in my car and drive off of a bridge, uh

Becky please come back :(((

 

Thumbnail avatar 86deefe954

butterflydusk44

Pen

  • Posted at:

Please tell us why you'd like to report this post

Ever After~

 well mr. fox i know you've got a secret to tell

 but folks, we live just to hear ourselves

 keep talk, non stop

 and it goes, until we know

 know not what to say

Thumbnail avatar af0c6c6246

skyscraperarrow12

PPAP... srry... i just had to...

  • Posted at:

Please tell us why you'd like to report this post

Destiny, Mai, Meanie, Dune, Mina

Rem:Scarlet/Soul

?WHO AM I REALLY?

A Warrior?

A Seeker?

A Fighter?

A Greencloak?

A Hero?

A Musician?

A Reader?

A Survivor?

A Challenger?

A Normal Girl?

A Ninjago Fan?

 

Turns out...

 

I'm all of them

 

And that's who I will always be...

Thumbnail avatar 6fc1c6d408

chickendragon428

What's that?(yep, this is what came to mind) 

  • Posted at:

Please tell us why you'd like to report this post

Cervidae

 

Hit or miss, I Guess she took the kids huh? 

Now I'm crying don't have no will to live, yuh

Gonna get in my car and drive off of a bridge, uh

Becky please come back :(((

 

Thumbnail avatar af0c6c6246

skyscraperarrow12

@Pepper: popular song... search it up...

  • Posted at:

Please tell us why you'd like to report this post

Destiny, Mai, Meanie, Dune, Mina

Rem:Scarlet/Soul

?WHO AM I REALLY?

A Warrior?

A Seeker?

A Fighter?

A Greencloak?

A Hero?

A Musician?

A Reader?

A Survivor?

A Challenger?

A Normal Girl?

A Ninjago Fan?

 

Turns out...

 

I'm all of them

 

And that's who I will always be...

Thumbnail avatar 2b4e58a204

brownwolf123

Scooby Doo

 

Alright, I only thought of Scooby Doo because of one of the shows had something that made me think of "What's that".

 

PLEASE LET THIS POST!

  • Posted at:

Please tell us why you'd like to report this post

Prank

CSBCJRKJPBSKS

MMMTBT

ASMJMRMNSUTM

RDPPFP

MMMMPL

CALLUZFCBPTPJEIBKSKKNBAMKS

GLMSZGMEAWASMFC

RWBYZSPHELVONYX

HNSAHU

FrKeAlHeChMN

SiFlCMAySaSiYuRyTkYkSAIbMyGyViElSBCa

MoMvPcWaSmOlIdNgSn

YnYgH/HYiYaSpLeDr

SuTaMgMDJDkRiKuKaRMGL

RSFSSIAMPRSMKCRHSPKHMRICESCPMMNY

Thumbnail avatar d1b2bd2460

opalbulldog46

Food

  • Posted at:

Please tell us why you'd like to report this post

Pizza Mirima Historia

Daughter of Hades

Just a random Redcloak

Bounty Hunter, Skylander, Junsong Warrior

Queen of Skylands, Sea Otters+

"Chop 'Till Ya Drop!" ~~Chopscotch (Skylanders)

Ever=Twin!

Gang@/241569

Thumbnail avatar 69c5bdcd08

dragonwizard4289

Food foght

  • Posted at:

Please tell us why you'd like to report this post

 

-=-Call me Athena-=-

 

Farewell, and may you have the best possible opportunities and life. Maybe I'll be back someday, but for now I just want to say thank you for everything.

 

 

Thumbnail avatar d1b2bd2460

opalbulldog46

Castleteria

 

DON'T JUDGE

  • Posted at:

Please tell us why you'd like to report this post

Pizza Mirima Historia

Daughter of Hades

Just a random Redcloak

Bounty Hunter, Skylander, Junsong Warrior

Queen of Skylands, Sea Otters+

"Chop 'Till Ya Drop!" ~~Chopscotch (Skylanders)

Ever=Twin!

Gang@/241569

Thumbnail avatar 3ec3391dac

dragonwolf2982

What's that?

 

(That's the first thing I thought of)

  • Posted at:

Please tell us why you'd like to report this post

Eternity EternaFlamCrandberrand Katrina

 

 

Bobcat Twin

 

Gang @/341306

 

#EternityIsAPancake

#OnlyOneSpeshalBubbles

#SaveIsaac2k18

#Deltasquad

 

UNDERTALE fan

Pegasister

Homestuckian

Icecream

 

"rAARRGH NO DARK LORD AARON" -Ocean 2k18

 

#RememberTheSAMB

Thumbnail avatar d1b2bd2460

opalbulldog46

Long story

(First thing I thought of to that question)

  • Posted at:

Please tell us why you'd like to report this post

Pizza Mirima Historia

Daughter of Hades

Just a random Redcloak

Bounty Hunter, Skylander, Junsong Warrior

Queen of Skylands, Sea Otters+

"Chop 'Till Ya Drop!" ~~Chopscotch (Skylanders)

Ever=Twin!

Gang@/241569

Thumbnail avatar 3ec3391dac

dragonwolf2982

Avalon: Web of Magic

  • Posted at:

Please tell us why you'd like to report this post

Eternity EternaFlamCrandberrand Katrina

 

 

Bobcat Twin

 

Gang @/341306

 

#EternityIsAPancake

#OnlyOneSpeshalBubbles

#SaveIsaac2k18

#Deltasquad

 

UNDERTALE fan

Pegasister

Homestuckian

Icecream

 

"rAARRGH NO DARK LORD AARON" -Ocean 2k18

 

#RememberTheSAMB

Thumbnail avatar d3a59d09ec

ravenfairy134

Fantasy

  • Posted at:

Please tell us why you'd like to report this post

morningstar

 

who can say if i've been changed for the better, but

because i knew you

i have been changed

for good    

 

 

 

paalam at salamat, samb.

coming back for a bit, but don't count on it

(translation: goodbye and thank you, samb.)

Thumbnail avatar 19ca1939e5

penguinfairy82

I play this at school and we call it chocolate poo.

  • Posted at:

Please tell us why you'd like to report this post

~Hootsie

-inactive as heck

-founder of GvE, great grandma of FWRPs

-will sometimes crawl out of my hidey hole

 

just. leave GvE alone. I'm sick of saying it

 

 

One of the few people who seems to realize that more than 6% of the world likes wolves

Thumbnail avatar dd6482efaa

angeldragon4125

@Mayari ~ Island.

  • Posted at:

Please tell us why you'd like to report this post

Speshal Bubbles

Just a quote-hungry pocket of air. Don't mind me.

 

Oof. #dryskingang

 

our hopes and expectations

black holes and revelations...

starlight

i will be chasing a starlight

until the end of my life

i don't know if it's worth it anymore...

Palm tree

  • Posted at:

Please tell us why you'd like to report this post

Pearl

 Alt account of someone you probably don't know

Life doesn't discriminate

Between the sinners and the saints

It takes and it takes and it takes

And we keep living anyway

Thumbnail avatar ec5c3bd0f4

rabbitpaw36

Texas

  • Posted at:

Please tell us why you'd like to report this post

Sunshine

Or Sakari

 

You're my constant in every moment

Constant

You've never failed me

All my life

You have never left my side

You are my constant

 

#SaveTheSouthernResidents

 

 

#StandWithSeaWorld

 

It never hurts to keep looking fosunshine.-Eeyore

Thumbnail avatar 6fc1c6d408

chickendragon428

Cows

  • Posted at:

Please tell us why you'd like to report this post

Cervidae

 

Hit or miss, I Guess she took the kids huh? 

Now I'm crying don't have no will to live, yuh

Gonna get in my car and drive off of a bridge, uh

Becky please come back :(((

 

Thumbnail avatar 5eae8c30c4

warriorcat182

Milk

  • Posted at:

Please tell us why you'd like to report this post

 I'm Sandstorm

 

FirestarLeafpoolSquirrelflightAshPikachuJessieJamesMeowthSnowheartLakeclaw

 

Queen of Pokemon,Co-Queen of SU

 

#ProudToBeGay

 

"I'm not gonna let you stand there and remind me of everything I hate about myself!" ~ Amethyst

Thumbnail avatar ec5c3bd0f4

rabbitpaw36

Longhorn

  • Posted at:

Please tell us why you'd like to report this post

Sunshine

Or Sakari

 

You're my constant in every moment

Constant

You've never failed me

All my life

You have never left my side

You are my constant

 

#SaveTheSouthernResidents

 

 

#StandWithSeaWorld

 

It never hurts to keep looking fosunshine.-Eeyore

Thumbnail avatar ec5c3bd0f4

rabbitpaw36

Change longhorn to allergy.

  • Posted at:

Please tell us why you'd like to report this post

Sunshine

Or Sakari

 

You're my constant in every moment

Constant

You've never failed me

All my life

You have never left my side

You are my constant

 

#SaveTheSouthernResidents

 

 

#StandWithSeaWorld

 

It never hurts to keep looking fosunshine.-Eeyore

Thumbnail avatar db756fcab7

artkitten320

me

  • Posted at:

Please tell us why you'd like to report this post

         ∆ Icicle

nerd | musical trash | INTJ-T | scorpio

 

"Now it's time to say goodbye

To the things we loved....

How the time seemed to fly."~RWBY

Thumbnail avatar 24a31254dc

wolfbird1019

You

  • Posted at:

Please tell us why you'd like to report this post

 

~Aura~

Flips-

~Venti~

~Nebrea~

 

 

It's spooky season!

 

Goddess of Imagination

Queen of WolvesAurae, and All Mythical Creatures

 

Gang @/281892

 

INFJ/INFP

 

 

》6/25/16《

 

 

 

 

 

 

 

 

 

 

 

 

Thumbnail avatar 26d845b575

rainelf13

Are

  • Posted at:

Please tell us why you'd like to report this post

Rain, Thane of Scholastica

 

9/25/2013 

 

Pokémon

JSE

Thrilling Intent

RWBY

Teratologist

Voltron

No Smarts but Hearts

 

Jaz|Xiang|Fenny|Ryoku|Pyro|Falco|Mei Long|Raife

  

We spent weeks cleaning the fun from the trees. - Karen

 

Thumbnail avatar d1b2bd2460

opalbulldog46

Ares

 

(Don't ask. I thought thats what Rain said)

  • Posted at:

Please tell us why you'd like to report this post

Pizza Mirima Historia

Daughter of Hades

Just a random Redcloak

Bounty Hunter, Skylander, Junsong Warrior

Queen of Skylands, Sea Otters+

"Chop 'Till Ya Drop!" ~~Chopscotch (Skylanders)

Ever=Twin!

Gang@/241569

Thumbnail avatar 3ec3391dac

dragonwolf2982

Percy Jackson

  • Posted at:

Please tell us why you'd like to report this post

Eternity EternaFlamCrandberrand Katrina

 

 

Bobcat Twin

 

Gang @/341306

 

#EternityIsAPancake

#OnlyOneSpeshalBubbles

#SaveIsaac2k18

#Deltasquad

 

UNDERTALE fan

Pegasister

Homestuckian

Icecream

 

"rAARRGH NO DARK LORD AARON" -Ocean 2k18

 

#RememberTheSAMB

Thumbnail avatar 86deefe954

butterflydusk44

Book.

  • Posted at:

Please tell us why you'd like to report this post

Ever After~

 well mr. fox i know you've got a secret to tell

 but folks, we live just to hear ourselves

 keep talk, non stop

 and it goes, until we know

 know not what to say

Thumbnail avatar 26d845b575

rainelf13

Magnus Chase

  • Posted at:

Please tell us why you'd like to report this post

Rain, Thane of Scholastica

 

9/25/2013 

 

Pokémon

JSE

Thrilling Intent

RWBY

Teratologist

Voltron

No Smarts but Hearts

 

Jaz|Xiang|Fenny|Ryoku|Pyro|Falco|Mei Long|Raife

  

We spent weeks cleaning the fun from the trees. - Karen

 

    1 , , 3 ... 6 , 7 , 8