Thumbnail avatar 86deefe954

butterflydusk44

*reads paper* *resists laughing* This year, there will be a dance of love *laughs* and joy *snickers*. It will be filled with- *insert a lot of laughing here*

I can't do this anymore. *wipes tear of amusement* It's too cheesy.

Anyways, you get the idea. It's a dance. Yeah. Stuff. 

 

FORM:

Name: (Full name)

Suit/Dress:

Appearance:

Suggestion for setting: 

Ship, Yes or No:

Shipmate: (Allowed to put "open")

Gang members?:

Job?:

 

Hope to see you at the dance of love and *snickers* magic and friendship! *bursts put laughing* You- *hahah* should make mem- *hahah* -ories that last a- *a lot of laughing* -l-lifetime! 

Okay, that was hilarious. Who wrote this script? 

  • Posted at:

Please tell us why you'd like to report this post

Ever After~

 well mr. fox i know you've got a secret to tell

 but folks, we live just to hear ourselves

 keep talk, non stop

 and it goes, until we know

 know not what to say

Thumbnail avatar f1da98cab5

joyfulcat108

Name: Dreamkeeper
Suit/Dress: For this dance, my hair will be braided down the center of my back. Red ribbons will be woven into the braid (cause I'm trying to be more festive). I'll be wearing a white flowing dress that is slightly higher in the front than the back, but the skirt overall reaches a little lower than my knees. Abstract flowers are embroidered into the skirt with thin red thread. The sleeves reach my elbow, but widens into a butterfly-style. I'll also wear silver sandals and my moonstone pendant, as usual.
Appearance: Long black hair that reaches her lower-waist, indigo eyes that can glare into oblivion, Asian skin tone and appearance,
Suggestion for setting: somewhere outside
Ship, Yes or No: no
Shipmate: none... :)
Gang members?: binge-re-reading at the library
Job?: guest

  • Posted at:

Please tell us why you'd like to report this post

Dreamkeeper

 

"I stand at the turning of the years"

"Before going their separate ways forever"

"No one deserves to fade away"

"Teach me how to say goodbye"

"I wish I had more TNT"

"They'd say I got no heart"

 

Current Stats—Hospital

RIP (rest in pieces)

Thumbnail avatar 86deefe954

butterflydusk44

Up

  • Posted at:

Please tell us why you'd like to report this post

Ever After~

 well mr. fox i know you've got a secret to tell

 but folks, we live just to hear ourselves

 keep talk, non stop

 and it goes, until we know

 know not what to say

Thumbnail avatar f5bda21c4d

happyhopeful24

Name: (Full name) Kryhsillia "Kryh/Happy" Opal Bey. 
Suit/Dress: Electric blue shirt, black leggings, mint teal sweater, electric purple Converse. (If you need to wear a dress, the leggings are a black skirt.)
Appearance: *sucks in deep breath* Straight black hair that is up to around where my ribcage is with ombré highlights and a blue and white streak in my bangs. Parted to the left. Brown eyes and tan skin with white markings on my arms, feet and under my right eye. 5ft 5in, not exactly pretty. 
Suggestion for setting: Underwater? 
Ship, Yes or No: Mmmmmaaaaaaaayyyyyyybbbbbbeeeeee........ *grabs phone*
Shipmate: (Allowed to put "open") Kylo. Maybe. Idk. 
Gang members?: Nada. 
Job?: Maybe DJ?

  • Posted at:

Please tell us why you'd like to report this post

happeh  

 

people come into our lives for a reason

bringing something we must learn

we are led to those who help us most to grow

we help them in return

i don't know if i believe that's true

but i know i'm who i am today

because i knew you

Thumbnail avatar 86deefe954

butterflydusk44

Name: Ever/Aturya Dusk Essanieraen 

Suit/Dress/Whatever the heck you want to wear: Green to yellow to orange to pink at the bottom ombre fabric dress down to that part between knee and ankle. It's flowy and simple, with no emblem. And some random grey ballet flats. 

Appearance: Wavy medium length black hair, hazel eyes, freckles, light eyebrows, and really pale tan skin. 

Suggestion for setting: --

Ship, yes or no?: Maybe? Probably not.

Shipmate: Well probably 99.99% nah.

Gang Members: Kylym. No one else. 

Job?: I'll be professional shipper/Organizing the food

  • Posted at:

Please tell us why you'd like to report this post

Ever After~

 well mr. fox i know you've got a secret to tell

 but folks, we live just to hear ourselves

 keep talk, non stop

 and it goes, until we know

 know not what to say

Thumbnail avatar 3e6f48276e

silverraven280

Name: Aerca/Étoile/Faelwen Riverdusk-Stargazer-Avery

 

Suit/Dress: I'll probably be wearing a long, flowing, sleeveless dress [made with tulle] that fades from white to dark blue. I have sort of a cloak-y thing that's attached to the dress; when I move it ripples out behind me, though otherwise it looks like a part of the dress. My hair will be in ringlets, with little sparkly silver things tucked in. I'll probably wear a silver tiara or headband that sparkles like my hair, as well as a silver necklace and bracelets embedded with sapphires to match. I'll be wearing silver high heel sandals, with shorter straps than my normal ones.

 

Appearance: I'm rather tall, about 6' and a little bit. I have pale blonde hair that's ombré to the color of navy blue I'm typing in. My eyes are icy blue, and I have pale skin, like Anna or perhaps Elsa from Frozen.

 

Suggestion for setting: West coast of SAMBria. I hear there's a nice beach there.

 

Ship, Yes or No: Well... maybe... #Aerconor

 

Shipmate: Conor MacFenray from the SA books, most likely. We're mostly just best friends, though.

 

Gang members?: Conor, Dag, Janga, Rivermist, Fireblaze, Caspian, and Kenori. [Conor and I are going together, Dag and Janga are going together, Rivermist and Fireblaze are going together, and the last 2 gang members are left as an exercise for the reader.]

 

Job?: I can help decorate! [I have a few ideas if we do end up being on SAMBria's west coast.]

  • Posted at:

Please tell us why you'd like to report this post

I'm Aerca [and this is my flipside, Enya ]

 

I am a... Greencloak FanWing Rufflerin Jedi Unwanted

 

My home forum is the SAMB. So is mine, apparently.

 

#SaveTheSouthernResidents #RememberLeia #MakeItSo

 

#Canada150 #Reformation500 #MoreSigSp-

Thumbnail avatar

pinkunicorn1988

Name: Rey. (thats it. )

 

Dress: Cute white valentines sweater, red skirt, red tights, white shoes,

 

appearance; brown curly hair, hazel eyes,  (rectangle-ish) glasses, average everything else, about 5 ft tall. maybe a little over. 

 

 

setting: Mybe ball room?

 

ship yes or no: not really?

 

Shipmate?open.

 

gang: Uh, no.

 

Job, greeter. 

  • Posted at:

Please tell us why you'd like to report this post

 

 

 

 

 

 

 

 

 

 

 

 "Yay Internet! She said sarcastically." -Skye (AoS) 

 

"Thank you, my friend." -Rey (SW TFA)

 

 

 

 

 

 

PROUCATHOLIC

 

 

 

 

Call Me Rey

 

 

 

 

 

 

 

#DontRunFromYourFateDaisy

 

 

 

member of Luke's new new Jedi Order

 

Name: Verity Evermore

Suit/Dress: Something black and sparkly and long. Not sure about details yet.

Appearance: Since Verity constantly changes appearances (since this is my brainchild we're discussing), I'm just going to stick with the basics that never change, which are: Black hair that reaches her mid-back, emerald eyes, anime body.

Suggestion for setting: Someplace romantic for the ships.

Ship, Yes or No: Yes

Shipmate: My gang member Middy (This party will literally be a throwback Thursday except not on a Thursday)

Gang members?: Not filling this out yet in case I make any changes to the gang.

Job?: As all my friends know, I am too lazy to have a job.

 

I just returned to the MB today and I'm already going to a party. :D

  • Posted at:

Please tell us why you'd like to report this post

Verity

 

Thank you all for everything.

 

/357163

Thumbnail avatar 129227c4ae

windprincess8

Name: Kagami-mochi
Suit/Dress: Korean hanbok with a white top, a red skirt,and red lining and cuffs, except with gold threads woven in the white and red fabric to make it shimmer. Also, she carries a round mirror about the size of a watermelon.
Appearance: Dark turquoise(almost black) hair with pale blue, red, and gold strands(not streaks) in a style like Kikyo from Inuyasha, creamy pale skin. Her eyes shift from deep pure blue to sea green to purple and gold and crimson, and every shade in between, and are generally large. Her expression is usually melancholy or looking down. Kagami is limber and curvy, looking around 14-15, average height, and has a delicate, slim build.
Suggestion for setting: mistletoe
Ship, Yes or No: possibly
Shipmate: too many
Gang members?: nope
Job?: official shipper

  • Posted at:

Please tell us why you'd like to report this post

i finally noticed somewhere along the way

the changing seasons painted the town a new color

fluttering flowers dance as my heart wavers

what will be left when it's all over?

in this bittersweet place

i want to stay my old self forever

  

2.28.15 - 3.14.19

Form-

Name: Hippie 

Suit/Dress: Lilac dress and silver flats

Appearance: Rainbow hair with wild flowers in it and lilac eyes

Suggestion for setting: Meadow!!!

Ship, Yes or No: ?

Shipmate: Open, I guess

Gang members?: None

Job?: Florist

  • Posted at:

Please tell us why you'd like to report this post

Hippie/Hippeh

Good Vibes

Flower Child

#Pray

#AllPeopleArePeople

#BellBottomsSquad

#LiveLoveLaugh

#KindnessOnlyMatters

#BeautyIsEveryWhere

#WereAllSad

 

P.s.

@Aerca

#Aerconor

  • Posted at:

Please tell us why you'd like to report this post

Hippie/Hippeh

Good Vibes

Flower Child

#Pray

#AllPeopleArePeople

#BellBottomsSquad

#LiveLoveLaugh

#KindnessOnlyMatters

#BeautyIsEveryWhere

#WereAllSad

 

Thumbnail avatar a5385d58c5

amberbutterfly669

wait, Kya made one of this too..

  • Posted at:

Please tell us why you'd like to report this post

-Amberwolf-*Snowlilyy*|Rebellious|

Essanieraen Mystical Traitare

<Catisar>

-Luxis-

Queen of wolf dragons

Rubyn|Silverjack|Aulumi|Echo|Jade|Skrill|Septys|Noire Rouge|Red Dusk|Valley

 #Amuke

 

Thumbnail avatar d657ea036f

aquaraven142

 

Name: Seeker ((The Unknown Hero))

 

Suit/Dress: My dress will be aqua blue with a silver sash around my waist. The dress will be sprinkled with aqua blue gem dust and silver specks. The dress itself will be sleeveless and shall have  2 inch thick straps. I will also wear silver heels with a medium thick strap across each ankle. And I will wear a silver chained necklace with a blue zircon pendant. 

 

Appearance: I will be 5.8 and have tan-like skin and my brown hair will be in a pixie cut, sprinkled with silver and aqua blue dust. I have broad shoulders and a more muscular build then most girls'.

 

Suggestion for setting: Near a sparkling lake.

 

Ship, Yes or No: Um... Sure?

 

Shipmate: Peter Parker/Spiderman ((Tom Holland))

 

Gang members?: They can't make it... They're to busy being heroes...

 

Job?: Photographer, artist, and DJ...

  • Posted at:

Please tell us why you'd like to report this post

}Seeker-Katherine-Hart-Traitares{

 

SAMBer since 2016

 

#Seeter

 

#SwimmerLife

 

Waffle=Twin

 

King Keith's official bodyguard/knight

 

Gang: Tara Zack Aaron Violet Amber Penny Ally Colin Nira Robin Ashton Sterling

Thumbnail avatar

hawktiger188

Name: Annora Evermoon

Suit/Dress: Short, flowy teal and sea green dress. The back is shorter than the front. Hair is in a beautiful, blonde side braid. I'm wearing silver flats to show my true height, which is tiny. I did some winged eyeliner and sea green eyeshadow with lipstick that has just a hint of blue.

Appearance: Very short, bright gray eyes, rosy cheeks, short(ish) blonde hair, and a blinding smile.

Suggestion for setting: A Night in Paris 

Ship, Yes or No: Not yet

Shipmate: Open

Gang members?: Lizbeth

Job?: Civilian 

 

  • Posted at:

Please tell us why you'd like to report this post

Annora  

Blonde Mormon Girl

 

Lizbeth, Sera, & Gerald

 

I do not spew profanities. I enunciate them clearly, like a bleeping lady.

Thumbnail avatar 0e294bc7a0

silvermist539

Name: Joy Viloette

Suit/Dress: Silver dress with light blue patterns on the bodice (Is that the right name? o.o)

Appearance: Hair down(basically no style) Auburn hair and green eyes

Suggestion for setting: I don't know... A forest?

Ship, Yes or No: No, I guess

Shipmate: (Allowed to put "open") Open

Gang members?: ?

Job?: ?

  • Posted at:

Please tell us why you'd like to report this post

-Joy

 

The world is quiet here. The SAMB soon will be too. 

I'll miss everyone, and I love you all. 

Wherever you're headed, good luck. 

 

Thumbnail avatar 86deefe954

butterflydusk44

@Amberwolf 

A lot of people made them. 

  • Posted at:

Please tell us why you'd like to report this post

Ever After~

 well mr. fox i know you've got a secret to tell

 but folks, we live just to hear ourselves

 keep talk, non stop

 and it goes, until we know

 know not what to say

Thumbnail avatar 7786084a38

tealelf182

What am I doing..

 

Name: Tale Inigma Smith

 

Suit/Dress: A teal silk dress with short sleeves that reaches to my knees, my hair is extremely dark brown and in a braid bun, and combat boots (Thanks Sadie Kane), a silver peach blossom is in my hair, thin dark blue short jacket.

 

Appereance: 4'11", slight tan, long legs, super dark brown eyes, hair is normally curly and fluffy (but not today)

 

Suggestion: A secret bunker

 

Ship: *Jumps in a river*

 

Ship mate: *Jumps in a lava river ina protective bubble*

 

Gang: Karen( just readin in the corner)

 

Job: COOOK

  • Posted at:

Please tell us why you'd like to report this post

Kanaya/Tale

Queen of Shoosh Paps

#Remember9/11

SPOOPY TIME

I will change my sig another day, too l a z y

Thumbnail avatar 5198179887

hawkphoenix123

Bookmark!

  • Posted at:

Please tell us why you'd like to report this post

Rajani

NightIlannRavenPyreAqPeri

 

ZerefKan

GlorySadieGriIvyClo

ErisAngSaphMewRQ

LunaChrysNMMAriaSonaSelAba

CynWhirlFWSunSpy

SuiBSSKKSAriOphEtoHiVaRiUmi

RSSayoAyaHinaEveChi

RaIALiMaYu

 

 

#Zerjani

 

Thumbnail avatar 86deefe954

butterflydusk44

Up.

  • Posted at:

Please tell us why you'd like to report this post

Ever After~

 well mr. fox i know you've got a secret to tell

 but folks, we live just to hear ourselves

 keep talk, non stop

 and it goes, until we know

 know not what to say

Thumbnail avatar d2bd57d5a5

jadewolf2493

Name: (Full name) Jenna Austindare Opacare Silvershade

Suit/Dress: Black floor length dress, the end of the fabric fades to amethyst purple. 

Appearance: Long black hair tied up into a braided bun. Violet eyes. Tall Canceland skinny. 

Suggestion for setting: Misty Forest. 

Ship, Yes or No: Sure.

Shipmate: (Allowed to put "open") OPEN

Gang members?: Nah. 

Job?: Anything that needs done. I'm good at organzing things.

  • Posted at:

Please tell us why you'd like to report this post

Jen~

 

< No definition found. Person does not exist_ >

 

Did you mean Failure?

 

All these voices in my head get loud

I wish that I could shut them out

I'm sorry that I let you down

Thumbnail avatar d1f3d74ed7

silvercat309

Name: Z Angelo-Marcos

Suit/Dress: Formal black suit. Nothin' special.

Appearance: Short black hair- slicked back, grey eyes, glasses. A touch of copper/orange eyeshadow to accent.

Suggestion for setting: Anything with snow.

Ship, Yes or No: NOPE.

Shipmate: See above.

Gang members?: Nada

Job?: I can dance, I can dj. Nothin' special.

  • Posted at:

Please tell us why you'd like to report this post

Z

Formerly Trick Graell

 

Agender

Preferred Pronouns: they/them

Thumbnail avatar a5385d58c5

amberbutterfly669

FORM:

Name: (Full name) Amberwolf/Snowlilyy/Rebellious Essanieraen Mystical (or just Amberwolf :P)

Suit/Dress: a red sleeveless dress with orange and yellos starting at the right shoulder spreading down to the bottom of the dress like a flame pattern

Appearance: braided black hair, black eyes, tan skin, a silver clasp bracelet thingy with a flame in the center

Suggestion for setting: Um. Outside. 

Ship, Yes or No: Yes

Shipmate: (Allowed to put "open") Luke but I dunno if he's active much anymore

Gang members?: Rubyn and Skrill because they're a ship :P and Noire Rouge so because she's new to the gang and wants to see what we do here xD I'd bring Kloof but she'd make a mess

Job?: Um. I can decorate.

  • Posted at:

Please tell us why you'd like to report this post

-Amberwolf-*Snowlilyy*|Rebellious|

Essanieraen Mystical Traitare

<Catisar>

-Luxis-

Queen of wolf dragons

Rubyn|Silverjack|Aulumi|Echo|Jade|Skrill|Septys|Noire Rouge|Red Dusk|Valley

 #Amuke

 

Thumbnail avatar a5385d58c5

amberbutterfly669

Im so sorry I forgot one couple:Willowstar and Lakestorm!

because #Willowstorm

Willowstar's warrior name is Willowbreeze.. maybe I shoudl use that for ships

  • Posted at:

Please tell us why you'd like to report this post

-Amberwolf-*Snowlilyy*|Rebellious|

Essanieraen Mystical Traitare

<Catisar>

-Luxis-

Queen of wolf dragons

Rubyn|Silverjack|Aulumi|Echo|Jade|Skrill|Septys|Noire Rouge|Red Dusk|Valley

 #Amuke

 

*pretends she's not in another V. Day Dance... XP*

 

Looks fun! I don't know anyone, though... 

 

Formal Name: Lady Latte

Causal Nickname: Daze/Daisy
Suit/Dress: Long, flowly, off-the-shoulder white dress with scarlet accessories and scarlet heels, a smart gold watch and gold jewelry. 
Appearance: Medium height, slanted hazel eyes, tanned skin, shoulder-length light chestnut hair, a scar on her neck. 
Suggestion for setting: A beach would be nice. 
Ship, Yes or No: Eh, sure, probably it's not going to happen. 
Shipmate: (Allowed to put "open") Open I guess?
Gang members?: Nope. 
Job?: Can help with greeting guests and/or setting up the food tables. 

  • Posted at:

Please tell us why you'd like to report this post

 

 Don't argue, just accept it- I rule general chat as the coffee queen!

 

 

#ChristianHomeschooledMilitaryBrat

 

#CoffeeSquad

 

#NoSameGenderShipping

 

 

"Say something I'm giving up on you..."

-Daze

 

"See? Forever doesn't last very long." -Daze

 

 

 

 

 

Thumbnail avatar 5198179887

hawkphoenix123

Name: Rajani Sakurako

Suit/Dress: Something light and graceful, nothing too neon or bright. I'm a fan of pastel colors. Probably a white or pastel purple/blue dress with white ballet flats (the ones with ribbons), with nothing much else- maybe some flower-related or ribbon accessories. For further elaboration, look up 'Hatsune Miku Pizzicato' or 'Hatsune Miku Cantatrice' on Google to get an image of what I'm thinking.

Appearance: Long silver hair flowing down to waist with pastel purple ombre at the tips (usually braided with ribbons), violet eyes with dragon pupils and pale skin. Elfen ears, very small build and a dragon motif if there is jewelry.

Suggestion for setting: Something magical and mysterious! Maybe a cosmic theme! That would be lovely.

Ship, Yes or No: Yep!

Shipmate: Zeref Dragneel. *drags him up and dumps him down* Here. Have fun!

Gang members?: This may change, but apart from Zeref, I'll probably bring along Riko and Umi from Love Live!, Iko from the Lunar Chronicles, Eris from Legends of Chima, Aria and Sonata from Equestria Girls: Rainbow Rocks, and the five Vocaloids. (Rana, IA, Lily, MAYU, Yukari).

Job?: Mm... I can sing and dance. Nothing special. I'm an idol-in-training in real life and on MB, so that's just a fun hobby!

  • Posted at:

Please tell us why you'd like to report this post

Rajani

NightIlannRavenPyreAqPeri

 

ZerefKan

GlorySadieGriIvyClo

ErisAngSaphMewRQ

LunaChrysNMMAriaSonaSelAba

CynWhirlFWSunSpy

SuiBSSKKSAriOphEtoHiVaRiUmi

RSSayoAyaHinaEveChi

RaIALiMaYu

 

 

#Zerjani

 

Thumbnail avatar f7f75357a2

azurelightning71

Name: Firework Lazuli

Suit/Dress: Dark blue, skin-tight outfit which moves so it looks like waves are traveling over it (basically a water version of Katniss's chariot costume from Catching Fire)

Appearance: Eyes the color of a raging sea, coppery hair tied back yandere style with a gold ribbon, District 4 look

Suggestion for setting: Anywhere's fine, as long as it has water

Ship, Yes or No: Maaaaaaaaaaaybe

Shipmate: Clove from THG

Gang members?: Nope (Except Clove)

Job?: Guest

  • Posted at:

Please tell us why you'd like to report this post

Firework

December 2015-March 2019

3992 stars

/357093

 

Who can say if I've been changed for the better?

But because I knew you

I have been changed

For good

Thumbnail avatar 2b4e58a204

brownwolf123

Name: NekoPrankster218 (don't judge)

Suit/Dress: A purple Cheongsam dress (china dress) with neon blue flower patterns, as well as red dress shoes. I'm wearing silver, sparkling glasses.

Appearance: My spikey brown hair has been curled, and I have brown eyes and lightly pale skin (probably Caucasian). I'm slightly taller than average for the 14 year old girl.

Suggestion for setting: On a cruise (cause get it, it's a "ship"?)

Ship, Yes or No: YES!!!! #Pripper!

Shipmate: MY BELOVED KIPPAI (Kipper to the rest of you)!

Gang members?: I'm not sure yet, it depends if their ship mates ask them (hint hint Dakku, there's a certain girl named Maria you should take)

Job?: Guest, I guess

 

PLEASE LET THIS POST!

  • Posted at:

Please tell us why you'd like to report this post

Prank

CSBCJRKJPBSKS

MMMTBT

ASMJMRMNSUTM

RDPPFP

MMMMPL

CALLUZFCBPTPJEIBKSKKNBAMKS

GLMSZGMEAWASMFC

RWBYZSPHELVONYX

HNSAHU

FrKeAlHeChMN

SiFlCMAySaSiYuRyTkYkSAIbMyGyViElSBCa

MoMvPcWaSmOlIdNgSn

YnYgH/HYiYaSpLeDr

SuTaMgMDJDkRiKuKaRMGL

RSFSSIAMPRSMKCRHSPKHMRICESCPMMNY

Thumbnail avatar 91bfad658e

turtlebear66

Name: Kipper
Suit/Dress: I think I'll just throw on this one hoodie I have with a tuxedo design on it.

Appearance: I'm a orange tabby cat. I have a a majestic tuft of darker orange hair with red tips. For once, it'll be neatly combed. Oh, and I have emerald eyes. Also, my left hind paw and underbelly are a weird pale orange/tan color. Oh, and I have these black freckle things on my muzzle. Did I also mention that I'm antrhopomorphic, so I generally walk on two legs.

Setting: The underworld, cause that's always fun.
Ship, Yes or No: Yeees. It's #Pripper.

Shipmate: *Vaguely points in Prank's direction* Prank. 'Cause. She's my girlfriend.

Gang members?: You're lookin' at 'em. Although, I'm not a gang member. I'm a headmate, mate. Well, I'm 'technically' a gang member. *Shrug* I guess I'll just list Dakku here because he'll probably ask out Maria.

Job? Well, majority of my talents include some type of violence, and assuming that won't be tolerated, I can kind of play piano.

  • Posted at:

Please tell us why you'd like to report this post

Katana

and

Kipper

MiLeoRaDo

IDCyFox

 PFPFoxPBBPMarPCPM

NFNBNFoxNCNCaNMFlaFeFrNFB

BabFFFFrBal

FreBoCh4GFCaOliStoSpPl

AzTyDaLDDa

ManReMaTCSFClSBBBJJWGWCWFWBWFr

PaG/SMeCha

PapBlOsJeFrAz

ObRhNiCo

7Sa

I'm not sure what we are. -Kip

RulerofFNAF/

PunGod

 

Thumbnail avatar 9e1db0e4ae

twilightchief24

Name: (Full name) Luke

Suit/Dress: suit. standard. get what i mean?

Appearance: identical to avatar

Suggestion for setting: Gym?

Ship, Yes or No: i guess yes

Shipmate: (Allowed to put "open") ... open

Gang members?: I brought along my long lost cousin Kule

Job?: Doorman

  • Posted at:

Please tell us why you'd like to report this post

I exist

Luke

Thumbnail avatar 380bb64382

unicorncat613

Name: Zoe Diamondtwister
Suit/Dress: A blue cocktail dress
Appearance: Light blue hair and light blue eyes
Suggestion for setting: A gymnasium. I don't care.
Ship, Yes or No: No
Shipmate: Open
Gang members?: Storm
Job?: just a guest

  • Posted at:

Please tell us why you'd like to report this post

Misty and Storm

 

#brokensquad

 

My gang:

 

Kitty

Kawaii

Gold

Dragon

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

LUKE DON'T YOU DARE PUT OPEN CAN'T YOU SEE AMBER RIGHT THERE? HM? 

  • Posted at:

Please tell us why you'd like to report this post

Ever After~

 painted with a dark stroke, dirty on the canvas

 creation was holy, we chose against it

 the devil he's evil, no need to proclaim

 it's the choices we make that bring glory 

 glory to his name! 

 

but u can call me ever

twin = ayita !